PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006695
Common NameLOC102604014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TALE
Protein Properties Length: 662aa    MW: 73888.4 Da    PI: 6.1842
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006695genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82e-094204571954
                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  PGSC0003DMP400006695 420 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 457
                           554459******************************88 PP

2BELL1231.3e-39286357172
                  BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           er++l++k +kL s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  PGSC0003DMP400006695 286 ERHDLESKMTKLFSMLDEVDRRYKEYYQQMQVVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 357
                           799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.8E-59210355IPR006563POX domain
PfamPF075263.8E-47216353IPR006563POX domain
PROSITE profilePS5007112.341398461IPR001356Homeobox domain
SMARTSM003894.4E-10401465IPR001356Homeobox domain
CDDcd000868.60E-13401462No hitNo description
SuperFamilySSF466892.48E-17402468IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28404467IPR009057Homeodomain-like
PfamPF059202.2E-17418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MSAYYSNLSN QREVLPMSFL PDQKFASYQS TGLSDSPVHL NQHSASVSYS ELPGQNYGEV  60
QTMKGKDEML FIPPTSESGG MQPIGRAVNA VPNFLENSVM MDPHSFPIKQ LLMPNGEQSL  120
QNQGLSLSLG TQVPPSLHVY SYQDDYTNSS LSSLVGTHVL HSEQGSENKE SKVAEYLSFD  180
LAGGTRAANN PQSSMTLREL NSGVHSHVGS GAAAAIYNSK YLKAVQDLLD EVVNVQEALK  240
QSDKLRNFNL LGHDRSEEAD FKSSSSATGI SGDHNNSTKG ELSATERHDL ESKMTKLFSM  300
LDEVDRRYKE YYQQMQVVVS SFEMVAGLGA AKPYTSLALK TISRQFRCLR DAIKKQIQVT  360
RRSLGEQGDS QGERLYRLRY VDQQLRQQRS LQQFGMMRQP WRPQRGLPET AVSVLRAWLF  420
EHFLHPYPKD SEKIMLARQT GLTRSQVANW FINARVRLWK PMIEDMYKEE FGVAEAGSGV  480
SPERVPVDSK EKSIAENTGE EIPESFTTPA ANCSHLDPSD ESRNNVTNVH NNSFTTKFSF  540
QDGVYEHERI DCGSSKLQSE QIPIAHGFGP KPTSDGSIIG AVNTYHPSMF GDIMGNQVSL  600
ALRLQNSQMD QQPMSGRPQL RQDEKTDSTH MDIGKGEYYY IDPVNQQERF SGPHLLSDFV  660
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B8e-17407464158Homeobox protein Meis1
4xrs_A8e-17407464158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341980.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_015161897.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLM0ZWL90.0M0ZWL9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-101BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]